PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s1413.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 266aa    MW: 29459.6 Da    PI: 5.5828
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s1413.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.7e-2197157257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          r+R+t+t+ ql++Le+ F + + +ps++++++++++l    ++ er+V++WFqNrRa+ k+
  Bostr.7867s1413.1.p  97 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKDITEELsqhgQIAERNVYNWFQNRRARSKR 157
                          89*****************99**************************************97 PP

2Wus_type_Homeobox103.12e-3396159265
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          ar+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i ++NV++WFQNr+aR+++kq
  Bostr.7867s1413.1.p  96 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQIAERNVYNWFQNRRARSKRKQ 159
                          789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-1792160IPR009057Homeodomain-like
PROSITE profilePS5007114.91693158IPR001356Homeobox domain
SuperFamilySSF466891.54E-1793159IPR009057Homeodomain-like
SMARTSM003899.6E-1595162IPR001356Homeobox domain
PfamPF000461.1E-1897157IPR001356Homeobox domain
CDDcd000867.40E-1397159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MMEWDNQQQP NNHHSSNLQG IDVNGGSGAG GGMYVKVMTD EQYETLRKQI AIYGTICERL  60
VEMHKTLTAQ QDLAGGRLGG LYADPMMSSI GHKMTARQRW TPTPVQLQIL ERIFDQGTGT  120
PSKQKIKDIT EELSQHGQIA ERNVYNWFQN RRARSKRKQH GGGSSGNNNG ESEVETEVEA  180
LNEKRERPES LLGLPDGNNN NNGIGTATTT TPRPEDLCFQ SPEMSSDLHL LGVLSNPRDE  240
HLVGKMGLSE SYNLYDHVED YGMSG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150158RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0482680.0AY048268.1 Arabidopsis thaliana AT4g35550/F8D20_60 mRNA, complete cds.
GenBankAY2514040.0AY251404.1 Arabidopsis thaliana WOX13 protein mRNA, complete cds.
GenBankBT0005380.0BT000538.1 Arabidopsis thaliana homeodomain - like protein (At4g35550/F8D20_60) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284087.11e-169hypothetical protein CARUB_v10005217mg
SwissprotO817881e-168WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLR0GXF71e-169R0GXF7_9BRAS; Uncharacterized protein
STRINGscaffold_700564.11e-168(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-142WUSCHEL related homeobox 13